Recombinant Human 4-1BB Ligand
Recombinant Human 4-1BB Ligand
4‐1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4‐1BBL binds to its receptor 4‐1BB, and provides a co‐stimulatory signal for T cell activation and expansion. The human 4‐1BBL gene codes for a 254 amino acid type II transmembrane protein containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane protein domain, and a 205 amino acid extracellular domain. The soluble form of 4‐1BBL contains the TNF‐like portion of the extracellular domain of 4‐1BBL. Recombinant Human 4‐1BB Ligand is a soluble 19.5 kDa protein consisting of 185 amino acid residues.
Catalog Number: AF-310-11
Manufactured using all Animal-Free reagents.
Source: HEK293
Synonyms: TNFSF9, CD137L
AA Sequence:
MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses
Biological Activity: Determined by its ability to induce CD137/NF-κB activation in HEK293 reporter cells.
Calculated Molecular Weight: 19.5 kDa
Accession Number: P41273
Gene ID: 8744
Not for human use.
$150.00 – $850.00



admin –
Nice
Vishal Ghosh –
Great